Structure of PDB 6dfc Chain A Binding Site BS01

Receptor Information
>6dfc Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dfc A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y503 V504 C505 S508 R511 Y536 Q563 R595 Q596
Binding residue
(residue number reindexed from 1)		Y23 V24 C25 S28 R31 Y56 Q83 R115 Q116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dfc, PDBe:6dfc, PDBj:6dfc
PDBsum6dfc
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]