Structure of PDB 6dfb Chain A Binding Site BS01

Receptor Information
>6dfb Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTAHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dfb A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		Y503 V504 S508 R511 E535 Y536 Q563 F564 Q596
Binding residue
(residue number reindexed from 1)		Y23 V24 S28 R31 E55 Y56 Q83 F84 Q116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dfb, PDBe:6dfb, PDBj:6dfb
PDBsum6dfb
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]