Structure of PDB 6df9 Chain A Binding Site BS01

Receptor Information
>6df9 Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVF
PLAQYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDS
KLYRLHPCRSLQIRQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6df9 A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution2.319 Å
Binding residue
(original residue number in PDB)		Y503 V504 C505 S508 R511 Q535 Y536 R595 Q596 Y597
Binding residue
(residue number reindexed from 1)		Y22 V23 C24 S27 R30 Q54 Y55 R114 Q115 Y116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6df9, PDBe:6df9, PDBj:6df9
PDBsum6df9
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]