Structure of PDB 6dcl Chain A Binding Site BS01

Receptor Information
>6dcl Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG
FGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKK
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH
DSVDKIVIQKYHTVNGHNCEVRKALSKQEMAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dcl Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		K15 F17 G19 G20 R55 F57 F59 E85 A89 V90 R92 S95 H101
Binding residue
(residue number reindexed from 1)		K9 F11 G13 G14 R49 F51 F53 E79 A83 V84 R86 S89 H95
Binding affinityPDBbind-CN: Kd=15.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6dcl, PDBe:6dcl, PDBj:6dcl
PDBsum6dcl
PubMed29946118
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]