Structure of PDB 6dcb Chain A Binding Site BS01

Receptor Information
>6dcb Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLS
IACKWGPSRMVGLDIDSRLIHSARQNIRHYLSTSVFPNNVVFVTGNYVLD
RDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGIL
VLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYEL
VATPHNTSKGFQRPVYLFHKARSPS
Ligand information
>6dcb Chain B (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaugugaggcuucggccucaccgcuccaugugcga
<<<.<<<<<<<....>>>>>>>...>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dcb Structural basis of 7SK RNA 5'-gamma-phosphate methylation and retention by MePCE.
Resolution1.998 Å
Binding residue
(original residue number in PDB)		Y418 C419 K420 Y421 G423 Y424 H456 S482 Q485 N486 R488 H489 Y490 K585 W586 Q618 R626 S671 G673 F674 R676
Binding residue
(residue number reindexed from 1)		Y8 C9 K10 Y11 G13 Y14 H46 S72 Q75 N76 R78 H79 Y80 K122 W123 Q155 R163 S208 G210 F211 R213
Binding affinityPDBbind-CN: Kd=100nM
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:6dcb, PDBe:6dcb, PDBj:6dcb
PDBsum6dcb
PubMed30559425
UniProtQ7L2J0|MEPCE_HUMAN 7SK snRNA methylphosphate capping enzyme (Gene Name=MEPCE)

[Back to BioLiP]