Structure of PDB 6d30 Chain A Binding Site BS01

Receptor Information
>6d30 Chain A (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSV
VLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTS
GHAQFLDLVSEVDRVMEEFNLTTFYQDPSFQLSLAWCVGDARLQLEGQCL
QELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d30 Structural and mechanistic basis for preferential deadenylation of U6 snRNA by Usb1.
Resolution1.17 Å
Binding residue
(original residue number in PDB)		M116 V118 H120 Y161 N163 F170 Y202 P205 S206 Q208
Binding residue
(residue number reindexed from 1)		M39 V41 H43 Y84 N86 F93 Y125 P128 S129 Q131
Enzymatic activity
Enzyme Commision number 4.6.1.-
Gene Ontology
Molecular Function
GO:0004518 nuclease activity
Biological Process
GO:0034477 U6 snRNA 3'-end processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6d30, PDBe:6d30, PDBj:6d30
PDBsum6d30
PubMed30215753
UniProtQ9BQ65|USB1_HUMAN U6 snRNA phosphodiesterase 1 (Gene Name=USB1)

[Back to BioLiP]