Structure of PDB 6d1t Chain A Binding Site BS01

Receptor Information
>6d1t Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTR
YLGPACDLTLFDFKQGIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d1t Complex of MBD1-MBD and methylated DNA
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R22 K23 S24 G25 A26 T27 R30 L69
Binding residue
(residue number reindexed from 1)		R21 K22 S23 G24 A25 T26 R29 L68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6d1t, PDBe:6d1t, PDBj:6d1t
PDBsum6d1t
PubMed
UniProtQ9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Gene Name=MBD1)

[Back to BioLiP]