Structure of PDB 6d12 Chain A Binding Site BS01

Receptor Information
>6d12 Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATGPQFVSGVIVKIISTEPLPGRKQVRDTMAAISEVLYVDLLEGDTECHA
RFKTPLDALAVINAYTEINKKHCWKMEILSGDHEQRYWQKILVDRQAKLN
Ligand information
>6d12 Chain C (length=38) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcugcauguggcagcucgggcugcauguggcagcuc
<<<<<<<.....>>>>>>>.<<<<<<.....>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d12 Structural basis for recognition of human 7SK long noncoding RNA by the La-related protein Larp7.
Resolution2.205 Å
Binding residue
(original residue number in PDB)
P449 R468 R472 Y483 V484 D485 R496 Y532 I536 D539 R540 K543
Binding residue
(residue number reindexed from 1)
P4 R23 R27 Y38 V39 D40 R51 Y87 I91 D94 R95 K98
Binding affinityPDBbind-CN: Kd=129nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6d12, PDBe:6d12, PDBj:6d12
PDBsum6d12
PubMed29946027
UniProtQ4G0J3|LARP7_HUMAN La-related protein 7 (Gene Name=LARP7)

[Back to BioLiP]