Structure of PDB 6cqq Chain A Binding Site BS01

Receptor Information

>6cqq Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPN
VLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPF
LPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>6cqq Chain C (length=13) Species: 11706 (HIV-1 M:B_HXB2R) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RFYKTLRAEQASQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6cqq CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Q9 F32 A52 S53 F54 G58 A61 N62 V65 N69
Binding residue (residue number reindexed from 1)	Q6 F29 A49 S50 F51 G55 A58 N59 V62 N66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6cqq, PDBe:6cqq, PDBj:6cqq
PDBsum	6cqq
PubMed	29884618
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]