Structure of PDB 6co4 Chain A Binding Site BS01

Receptor Information
>6co4 Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNV
EDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEE
HCRKVNEYLNNPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6co4 Structure of the Rpn13-Rpn2 complex provides insights for Rpn13 and Uch37 as anticancer targets.
ResolutionN/A
Binding residue
(original residue number in PDB)		L33 T36 T37 V38 P40 K44 Q87 C88 R104 F106 W108 Q110
Binding residue
(residue number reindexed from 1)		L14 T17 T18 V19 P21 K25 Q68 C69 R85 F87 W89 Q91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:6co4, PDBe:6co4, PDBj:6co4
PDBsum6co4
PubMed28598414
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]