Structure of PDB 6cn8 Chain A Binding Site BS01

Receptor Information
>6cn8 Chain A (length=152) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAA
LE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cn8 High-Resolution Structure of ClpC1-Rufomycin and Ligand Binding Studies Provide a Framework to Design and Optimize Anti-Tuberculosis Leads.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
M1 F2 V13 H77 I78 P79 F80 K85 L88 E89
Binding residue
(residue number reindexed from 1)
M1 F2 V13 H77 I78 P79 F80 K85 L88 E89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6cn8, PDBe:6cn8, PDBj:6cn8
PDBsum6cn8
PubMed30990022
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]