Structure of PDB 6cmn Chain A Binding Site BS01

Receptor Information
>6cmn Chain A (length=91) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNSKIKKDELKKSLHAIFSRFGQILDILVPRQRTPRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDKRIPA
Ligand information
>6cmn Chain D (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagaucugagccugggagcucucugc
<<<<<...<<<<......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cmn Structure of HIV TAR in complex with a Lab-Evolved RRM provides insight into duplex RNA recognition and synthesis of a constrained peptide that impairs transcription.
Resolution1.796 Å
Binding residue
(original residue number in PDB)		Y13 K22 K23 R47 Q48 R49 R52 Q54 Q85 A87 K88
Binding residue
(residue number reindexed from 1)		Y9 K18 K19 R43 Q44 R45 R48 Q50 Q81 A83 K84
Binding affinityPDBbind-CN: Kd=2.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6cmn, PDBe:6cmn, PDBj:6cmn
PDBsum6cmn
PubMed29961805
UniProtG1TM83

[Back to BioLiP]