Structure of PDB 6cev Chain A Binding Site BS01

Receptor Information
>6cev Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
RYLGGSMDLSTFDFRTGKMLM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cev Structural analyses reveal that MBD3 is a methylated CG binder.
Resolution2.005 Å
Binding residue
(original residue number in PDB)
R44 S45
Binding residue
(residue number reindexed from 1)
R44 S45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6cev, PDBe:6cev, PDBj:6cev
PDBsum6cev
PubMed30980593
UniProtO95983|MBD3_HUMAN Methyl-CpG-binding domain protein 3 (Gene Name=MBD3)

[Back to BioLiP]