Structure of PDB 6cdp Chain A Binding Site BS01

Receptor Information
>6cdp Chain A (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGADLVRPGASVTLSCKASGYTFTDYEMHWMKQTPVHGLEWIGA
IVPETGYTAYNQKFKGKAILTADKSSNTVYMQFRSLTSEDSAVYYCSRLK
LLGYFDVWGTGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKSC
Ligand information
>6cdp Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cdp Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution2.456 Å
Binding residue
(original residue number in PDB)		T30 D31 E33 E54 Y57 L99 L101 L102 G103
Binding residue
(residue number reindexed from 1)		T30 D31 E33 E54 Y57 L99 L101 L102 G103
External links