Structure of PDB 6cdo Chain A Binding Site BS01

Receptor Information
>6cdo Chain A (length=230) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLQSGAELVRPGASVTLSCKASGYAFSDYEIHWVKQTPVRGLDWIGA
FDPKSGASASNQKVKGRAILTADKSSSTAYMELRSLTSEDSAVYYCTRLR
YFGYFDVWGTGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKSCDKGLEVLFQ
Ligand information
>6cdo Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cdo Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution2.099 Å
Binding residue
(original residue number in PDB)		E33 A57 S58 L99 Y101 F102 G103
Binding residue
(residue number reindexed from 1)		E33 A57 S58 L99 Y101 F102 G103
External links