Structure of PDB 6cdc Chain A Binding Site BS01

Receptor Information
>6cdc Chain A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTT
FFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYFNSDDFDYEELK
NGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHR
SSEWYQSLNLTHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cdc Molecular basis of GID4-mediated recognition of degrons for the Pro/N-end rule pathway.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
Q132 K135 L164 E237 G251 A252 S253 Y258 Y273 H275 S277 S278 Q282
Binding residue
(residue number reindexed from 1)
Q9 K12 L41 E111 G125 A126 S127 Y132 Y147 H149 S151 S152 Q156
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6cdc, PDBe:6cdc, PDBj:6cdc
PDBsum6cdc
PubMed29632410
UniProtQ8IVV7|GID4_HUMAN Glucose-induced degradation protein 4 homolog (Gene Name=GID4)

[Back to BioLiP]