Structure of PDB 6ccu Chain A Binding Site BS01

Receptor Information
>6ccu Chain A (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTF
FEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYASFNSDDFDYEEL
KNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYH
RSSEWYQSLNLTHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ccu Molecular basis of GID4-mediated recognition of degrons for the Pro/N-end rule pathway.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
L164 E237 G251 A252 S253 Y258 Y273 H275 S278
Binding residue
(residue number reindexed from 1)
L40 E112 G126 A127 S128 Y133 Y148 H150 S153
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ccu, PDBe:6ccu, PDBj:6ccu
PDBsum6ccu
PubMed29632410
UniProtQ8IVV7|GID4_HUMAN Glucose-induced degradation protein 4 homolog (Gene Name=GID4)

[Back to BioLiP]