Structure of PDB 6ccg Chain A Binding Site BS01

Receptor Information
>6ccg Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQL
ARYLGGSMDLSTFDFRTGKMLM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ccg Structural analyses reveal that MBD3 is a methylated CG binder.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R22 S24 L26 S27 D32 K42
Binding residue
(residue number reindexed from 1)		R23 S25 L27 S28 D33 K43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ccg, PDBe:6ccg, PDBj:6ccg
PDBsum6ccg
PubMed30980593
UniProtO95983|MBD3_HUMAN Methyl-CpG-binding domain protein 3 (Gene Name=MBD3)

[Back to BioLiP]