Structure of PDB 6c48 Chain A Binding Site BS01

Receptor Information
>6c48 Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
METLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIS
IEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYE
Ligand information
>6c48 Chain C (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAWKTVACGGTRDQLFMQEKARQLLGRL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c48 Structural mechanism of Myb-MuvB assembly.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		Q401 A405 V408 L409 E412 N415 N419
Binding residue
(residue number reindexed from 1)		Q54 A58 V61 L62 E65 N68 N72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0017053 transcription repressor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c48, PDBe:6c48, PDBj:6c48
PDBsum6c48
PubMed30224471
UniProtQ5TKA1|LIN9_HUMAN Protein lin-9 homolog (Gene Name=LIN9)

[Back to BioLiP]