Structure of PDB 6c31 Chain A Binding Site BS01

Receptor Information

>6c31 Chain A (length=195) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAGVTRGAMYHQF
ADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVSG
DPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQP
VRPLAQVLIGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLN

Ligand information

>6c31 Chain K (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acaagcagactgccggtaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6c31 Cytokinin Signaling in Mycobacterium tuberculosis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R6 T37 R48 Y52 D57 K58
Binding residue (residue number reindexed from 1)	R1 T32 R43 Y47 D52 K53
Binding affinity	PDBbind-CN: Kd=357nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6c31, PDBe:6c31, PDBj:6c31
PDBsum	6c31
PubMed	29921668
UniProt	O53623

[Back to BioLiP]