Structure of PDB 6c2s Chain A Binding Site BS01

Receptor Information
>6c2s Chain A (length=142) Species: 258594 (Rhodopseudomonas palustris CGA009) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELKMGELSELLGYALKRAQLRVFEDFLHCVAPVQLTPAQFSVLLLLDAN
PGRNQTEIATTLGILRPNFVAMLDALEGRGLCVRTRSPSDRRSHILMLTD
KGRATLARAKKLVATRHEDRLTELLGRDNRDALLSMLATIAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c2s Structural basis of transcriptional regulation by CouR, a repressor of coumarate catabolism, inRhodopseudomonas palustris.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		N93 Q94 T95 R105 P106 R123 R131 S132 H133
Binding residue
(residue number reindexed from 1)		N54 Q55 T56 R66 P67 R84 R92 S93 H94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6c2s, PDBe:6c2s, PDBj:6c2s
PDBsum6c2s
PubMed29794028
UniProtQ6N8V9

[Back to BioLiP]