Structure of PDB 6c24 Chain A Binding Site BS01

Receptor Information
>6c24 Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFI
FNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPI
THILVCRPKRTKASMSEFLESED
Ligand information
>6c24 Chain E (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PATQISDLSKRKPKTEDFLTFLCLRGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c24 Structures of human PRC2 with its cofactors AEBP2 and JARID2.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F429 F432 T442 E443 A444 P451 W452
Binding residue
(residue number reindexed from 1)		F4 F7 T17 E18 A19 P26 W27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0031490 chromatin DNA binding
GO:0035064 methylated histone binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0106222 lncRNA binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0045596 negative regulation of cell differentiation
GO:0048709 oligodendrocyte differentiation
GO:0060816 random inactivation of X chromosome
GO:0140718 facultative heterochromatin formation
Cellular Component
GO:0001739 sex chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005677 chromatin silencing complex
GO:0005730 nucleolus
GO:0016586 RSC-type complex
GO:0016604 nuclear body
GO:0032993 protein-DNA complex
GO:0035098 ESC/E(Z) complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c24, PDBe:6c24, PDBj:6c24
PDBsum6c24
PubMed29348366
UniProtQ15022|SUZ12_HUMAN Polycomb protein SUZ12 (Gene Name=SUZ12)

[Back to BioLiP]