Structure of PDB 6c0h Chain A Binding Site BS01

Receptor Information
>6c0h Chain A (length=114) Species: 53446 (Streptomyces cinnamoneus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTIYQDVDIIRRIQELMVLCSLLPPDGKLREALELALALHEEPALARIT
PLTNLHPFATKAWLETLWLGEGVSSEEKELVAWQNKSENMGPAIRELKNA
EQQSGITLVARLTS
Ligand information
>6c0h Chain C (length=14) Species: 53446 (Streptomyces cinnamoneus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QACAFGPFPFVCDG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0h Substrate-assisted enzymatic formation of lysinoalanine in duramycin.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F63 K66 E70 L74 Q89 N90 S92 G96
Binding residue
(residue number reindexed from 1)		F58 K61 E65 L69 Q84 N85 S87 G91
Enzymatic activity
Enzyme Commision number ?
External links