Structure of PDB 6c0a Chain A Binding Site BS01

Receptor Information
>6c0a Chain A (length=71) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPD
SVPGALDYMSFSTALYGESDL
Ligand information
>6c0a Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKFYATFLIQEYFRKFKKRKEQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0a Chemical shift assignments of the C-terminal EF-hand domain of a-actinin-1.
ResolutionN/A
Binding residue
(original residue number in PDB)
T825 A826 S832 L836 E847 E851 E889 D891
Binding residue
(residue number reindexed from 1)
T4 A5 S11 L15 E26 E30 E68 D70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6c0a, PDBe:6c0a, PDBj:6c0a
PDBsum6c0a
PubMed
UniProtQ7TPR4|ACTN1_MOUSE Alpha-actinin-1 (Gene Name=Actn1)

[Back to BioLiP]