Structure of PDB 6bxg Chain A Binding Site BS01

Receptor Information
>6bxg Chain A (length=98) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSLEGIGAVLQMTDDYTIIRSLVAGGPAALSKQLGEGDRIIGVGQEGEDV
VDVVGWRLDDVVQLIKGPKGSKVKLLVLPEGKDAKSHVVTIVRDKIRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bxg 1.45 Angstrom Resolution Crystal Structure of PDZ domain of Carboxy-Terminal Protease from Vibrio cholerae in Complex with Peptide.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		L246 G248 I249 G250 A251 V252 L253 K309
Binding residue
(residue number reindexed from 1)		L3 G5 I6 G7 A8 V9 L10 K66
Enzymatic activity
Enzyme Commision number ?
External links