Structure of PDB 6bux Chain A Binding Site BS01

Receptor Information
>6bux Chain A (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHSMDPATFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVKLAQRRGFLA
NQAKHKHGFLEGRHAALCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQ
EMAKFISKNKHVSLCIKTARIYDDKGRAAEGLRTLAEAGAKISIMTYSEF
KHCWDTFVDHQGAPFQPWDGLDEHSQDLSGRLRAILQNQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bux Crystal structure of the catalytic domain of HIV-1 restriction factor APOBEC3G in complex with ssDNA.
Resolution1.856 Å
Binding residue
(original residue number in PDB)		W211 R213 H216 T218 N244 A246 K247 H257 W285 S286 Y315 D316 D317 K318
Binding residue
(residue number reindexed from 1)		W18 R20 H23 T25 N51 A53 K54 H64 W92 S93 Y122 D123 D124 K125
Binding affinityPDBbind-CN: Kd=55uM
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity

View graph for
Molecular Function
External links
PDB RCSB:6bux, PDBe:6bux, PDBj:6bux
PDBsum6bux
PubMed29941968
UniProtQ9HC16|ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G (Gene Name=APOBEC3G)

[Back to BioLiP]