Structure of PDB 6bsf Chain A Binding Site BS01

Receptor Information
>6bsf Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bsf General and sequence-specific roles for DNA in glucocorticoid receptor DNA-binding stoichiometry
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S440 R470
Binding residue
(residue number reindexed from 1)		S23 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bsf, PDBe:6bsf, PDBj:6bsf
PDBsum6bsf
PubMed
UniProtP79269|GCR_SAGOE Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]