Structure of PDB 6bse Chain A Binding Site BS01

Receptor Information
>6bse Chain A (length=73) Species: 9490 (Saguinus oedipus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIID
KIRRKNCPACRYRKCLQAGMNLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bse General and sequence-specific roles for DNA in glucocorticoid receptor DNA-binding stoichiometry
Resolution2.35 Å
Binding residue
(original residue number in PDB)		C431 Y433
Binding residue
(residue number reindexed from 1)		C15 Y17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bse, PDBe:6bse, PDBj:6bse
PDBsum6bse
PubMed
UniProtP79269|GCR_SAGOE Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]