Structure of PDB 6bra Chain A Binding Site BS01

Receptor Information
>6bra Chain A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWKRPLVTIKIGGQLKEALLNTGADDTVIEEMSLPGRWKPKMIGGI
GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bra A substrate selected by phage display exhibits enhanced side-chain hydrogen bonding to HIV-1 protease.
Resolution1.111 Å
Binding residue
(original residue number in PDB)		R8 G27 A28 D29 D30 K45 I47 G48 V82
Binding residue
(residue number reindexed from 1)		R8 G27 A28 D29 D30 K45 I47 G48 V82
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bra, PDBe:6bra, PDBj:6bra
PDBsum6bra
PubMed29968678
UniProtQ5RZ08

[Back to BioLiP]