Structure of PDB 6blw Chain A Binding Site BS01

Receptor Information
>6blw Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEKRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSR
SDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKSCRWPSCQ
LVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6blw Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.835 Å
Binding residue
(original residue number in PDB)		K332 Y334 F335 K336 H339 R342 K346 R362 F364 R366 R372 H373 R376 R390 F392 R394 H397 H401 T404
Binding residue
(residue number reindexed from 1)		K16 Y18 F19 K20 H23 R26 K30 R46 F48 R50 R56 H57 R60 R74 F76 R78 H81 H85 T88
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6blw, PDBe:6blw, PDBj:6blw
PDBsum6blw
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]