Structure of PDB 6bjh Chain A Binding Site BS01

Receptor Information
>6bjh Chain A (length=143) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNQD
NPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLG
ANQVGCSYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQL
Ligand information
>6bjh Chain C (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgaaguauuccgcguacguu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bjh Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		W39 S62 K67 V69 S113 R115 S120
Binding residue
(residue number reindexed from 1)		W37 S58 K63 V65 S109 R111 S116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bjh, PDBe:6bjh, PDBj:6bjh
PDBsum6bjh
PubMed31021526
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]