Structure of PDB 6bhx Chain A Binding Site BS01

Receptor Information
>6bhx Chain A (length=98) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTEADFINCVT
WRRQAENVANFLKKGSLAGVDGRLQTRNYGQRVFVTEVQAESVQFLEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bhx Structural Mechanisms of Cooperative DNA Binding by Bacterial Single-Stranded DNA-Binding Proteins.
Resolution2.936 Å
Binding residue
(original residue number in PDB)		R56 N60 V100 Q101 F102
Binding residue
(residue number reindexed from 1)		R53 N57 V93 Q94 F95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bhx, PDBe:6bhx, PDBj:6bhx
PDBsum6bhx
PubMed30472092
UniProtP37455|SSBA_BACSU Single-stranded DNA-binding protein A (Gene Name=ssbA)

[Back to BioLiP]