Structure of PDB 6bgh Chain A Binding Site BS01

Receptor Information
>6bgh Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSL
RDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bgh The BRD3 ET domain recognizes a short peptide motif through a mechanism that is conserved across chromatin remodelers and transcriptional regulators.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y574 K577 R578 S581 I584 G589 L592 R607 I614 E615 I616 D617 F618 E619
Binding residue
(residue number reindexed from 1)		Y18 K21 R22 S25 I28 G33 L36 R51 I58 E59 I60 D61 F62 E63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6bgh, PDBe:6bgh, PDBj:6bgh
PDBsum6bgh
PubMed29567837
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]