Structure of PDB 6bfk Chain A Binding Site BS01

Receptor Information
>6bfk Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETF
RNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIF
GTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bfk Modifications to a common phosphorylation network provide individualized control in caspases.
Resolution1.753 Å
Binding residue
(original residue number in PDB)
R64 H121 C163
Binding residue
(residue number reindexed from 1)
R36 H93 C135
Enzymatic activity
Catalytic site (original residue number in PDB) T62 S63 H121 G122 C163
Catalytic site (residue number reindexed from 1) T34 S35 H93 G94 C135
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6bfk, PDBe:6bfk, PDBj:6bfk
PDBsum6bfk
PubMed29414778
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]