Structure of PDB 6bek Chain A Binding Site BS01

Receptor Information
>6bek Chain A (length=92) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AALEKAAAARRERAEVKNRLKHSGASLHEVIKQGQENDVIGKMKVSALLE
SLPGVGKVRAKQIMERLGISESRRVRGLGSNQIASLEREFGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bek Streptomyces IHF uses multiple interfaces to bind DNA.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		S82 R85 G91 N93 Q94
Binding residue
(residue number reindexed from 1)		S70 R73 G79 N81 Q82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bek, PDBe:6bek, PDBj:6bek
PDBsum6bek
PubMed31376411
UniProtQ9KXR9|IHF_STRCO Integration host factor (Gene Name=sihF)

[Back to BioLiP]