Structure of PDB 6bc8 Chain A Binding Site BS01

Receptor Information
>6bc8 Chain A (length=205) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPV
QMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEI
TQPPLLSISSDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHT
REAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLY
VEERA
Ligand information
>6bc8 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKKIVIMPCKCAPSRQLVQVWLQAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bc8 Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
Resolution1.68 Å
Binding residue
(original residue number in PDB)		E35 V36 Y37 G40 I41 C56 H57 P58 E59 Y63 E81 C144 F146 V148 L149 V150 H151 T152 E154 A156 M160 P170 W171 I172 L173 A174 D178
Binding residue
(residue number reindexed from 1)		E33 V34 Y35 G38 I39 C54 H55 P56 E57 Y61 E79 C142 F144 V146 L147 V148 H149 T150 E152 A154 M158 P168 W169 I170 L171 A172 D176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008432 JUN kinase binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001558 regulation of cell growth
GO:0002208 somatic diversification of immunoglobulins involved in immune response
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0007015 actin filament organization
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0010628 positive regulation of gene expression
GO:0010718 positive regulation of epithelial to mesenchymal transition
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0010944 negative regulation of transcription by competitive promoter binding
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0042177 negative regulation of protein catabolic process
GO:0042276 error-prone translesion synthesis
GO:0042772 DNA damage response, signal transduction resulting in transcription
GO:0043247 telomere maintenance in response to DNA damage
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045830 positive regulation of isotype switching
GO:0045893 positive regulation of DNA-templated transcription
GO:0051301 cell division
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:1901203 positive regulation of extracellular matrix assembly
GO:1904667 negative regulation of ubiquitin protein ligase activity
GO:2000042 negative regulation of double-strand break repair via homologous recombination
GO:2000048 negative regulation of cell-cell adhesion mediated by cadherin
GO:2000678 negative regulation of transcription regulatory region DNA binding
GO:2001034 positive regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0016035 zeta DNA polymerase complex
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bc8, PDBe:6bc8, PDBj:6bc8
PDBsum6bc8
PubMed30111544
UniProtQ9UI95|MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B (Gene Name=MAD2L2)

[Back to BioLiP]