Structure of PDB 6b9m Chain A Binding Site BS01

Receptor Information
>6b9m Chain A (length=150) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGPEEIVYH
VKYEDYPENGVVQLRGKDVRPRARTVYQWRQLEPGMIVMVNYNPDDPKER
GYWYDAEIQRKRETRTQREVFGKILLGDAGDSLNDCRIMFVTEIYKIEEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b9m An Intramolecular Interaction of UHRF1 Reveals Dual Control for Its Histone Association.
Resolution1.68 Å
Binding residue
(original residue number in PDB)
D144 D147 N149 M150 F154 E155 Y180 D182 Y183 N186 V189 M216 R227 G228 Y229 W230
Binding residue
(residue number reindexed from 1)
D17 D20 N22 M23 F27 E28 Y53 D55 Y56 N59 V62 M89 R100 G101 Y102 W103
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:6b9m, PDBe:6b9m, PDBj:6b9m
PDBsum6b9m
PubMed29395786
UniProtE7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 (Gene Name=uhrf1)

[Back to BioLiP]