Structure of PDB 6b9h Chain A Binding Site BS01

Receptor Information
>6b9h Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLN
RIKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEH
SDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMS
K
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b9h A conserved interaction of the dynein light intermediate chain with dynein-dynactin effectors necessary for processivity.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Q133 I136 I139 M140 E144 Q147 M151 Q155
Binding residue
(residue number reindexed from 1)		Q124 I127 I130 M131 E135 Q138 M142 Q146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030705 cytoskeleton-dependent intracellular transport

View graph for
Biological Process
External links
PDB RCSB:6b9h, PDBe:6b9h, PDBj:6b9h
PDBsum6b9h
PubMed29515126
UniProtQ86VS8|HOOK3_HUMAN Protein Hook homolog 3 (Gene Name=HOOK3)

[Back to BioLiP]