Structure of PDB 6b67 Chain A Binding Site BS01

Receptor Information

>6b67 Chain A (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLE
SWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGI
RTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGESRGLL
CRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFD
YKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELC
DFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKV

Ligand information

>6b67 Chain D (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MSIYVA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6b67 A trapped human PPM1A-phosphopeptide complex reveals structural features critical for regulation of PPM protein phosphatase activity.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	G2 A3 R33 H62 A63 R186 L191 A192
Binding residue (residue number reindexed from 1)	G1 A2 R32 H61 A62 R185 L190 A191

Enzymatic activity

Enzyme Commision number

3.1.3.16: protein-serine/threonine phosphatase.

Gene Ontology

	Molecular Function
GO:0004722	protein serine/threonine phosphatase activity
GO:0043169	cation binding

	Biological Process
GO:0006470	protein dephosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6b67, PDBe:6b67, PDBj:6b67
PDBsum	6b67
PubMed	29602904
UniProt	P35813\|PPM1A_HUMAN Protein phosphatase 1A (Gene Name=PPM1A)

[Back to BioLiP]