Structure of PDB 6b0r Chain A Binding Site BS01

Receptor Information
>6b0r Chain A (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSRSD
QLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSC
QKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0r Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.818 Å
Binding residue
(original residue number in PDB)		R321 Y334 K336 H339 R342 R366 R372 H373 R376 R390 R394 H397 H401 T404 K420 F422 R424 R430
Binding residue
(residue number reindexed from 1)		R3 Y16 K18 H21 R24 R48 R54 H55 R58 R72 R76 H79 H83 T86 K102 F104 R106 R112
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0r, PDBe:6b0r, PDBj:6b0r
PDBsum6b0r
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]