Structure of PDB 6b0o Chain A Binding Site BS01

Receptor Information
>6b0o Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSD
QLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSC
QKKFARSDELVRHHNMHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0o Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.552 Å
Binding residue
(original residue number in PDB)		R321 K332 Y334 H339 K346 F364 R366 Q369 R372 H373 R376 R390 S393 R394 H397 H401 T404 R424 E427 R430
Binding residue
(residue number reindexed from 1)		R3 K14 Y16 H21 K28 F46 R48 Q51 R54 H55 R58 R72 S75 R76 H79 H83 T86 R106 E109 R112
Binding affinityPDBbind-CN: Kd=45nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0o, PDBe:6b0o, PDBj:6b0o
PDBsum6b0o
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]