Structure of PDB 6aze Chain A Binding Site BS01

Receptor Information
>6aze Chain A (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQC
QSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYY
GVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQ
CAEVLESFFVQKLKGFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6aze Quantitative and structural assessment of methyllysine analog engagement by cognate binding proteins reveals decrements that can impact qualitative experiment interpretation
Resolution2.451 Å
Binding residue
(original residue number in PDB)		Y10 Y17 E19 S20 F22 Y23 I24 G25 C26 D27 W32 I48 D49
Binding residue
(residue number reindexed from 1)		Y4 Y11 E13 S14 F16 Y17 I18 G19 C20 D21 W26 I42 D43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016589 NURF complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6aze, PDBe:6aze, PDBj:6aze
PDBsum6aze
PubMed
UniProtQ12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF (Gene Name=BPTF)

[Back to BioLiP]