Structure of PDB 6aya Chain A Binding Site BS01

Receptor Information

>6aya Chain A (length=214) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTM
LNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIA
GTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQ
GPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKAL
GPGATLEEMMTACQ

Ligand information

>6aya Chain B (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SPSGVFTFG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6aya Multidisciplinary studies with mutated HIV-1 capsid proteins reveal structural mechanisms of lattice stabilization.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	N53 L56 N57 M66 K70
Binding residue (residue number reindexed from 1)	N48 L51 N52 M61 K65

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:6aya, PDBe:6aya, PDBj:6aya
PDBsum	6aya
PubMed	37699872
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]