Structure of PDB 6axk Chain A Binding Site BS01

Receptor Information
>6axk Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVESGGGVVPPGRSLRLSCATSGFTFSNYGMHWVRQAPGKGLEWVAI
IWYDGSRNFYAASVEGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCARAA
YYDTSGYGDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPKS
Ligand information
>6axk Chain E (length=11) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6axk Structural basis for antibody recognition of the NANP repeats in Plasmodium falciparum circumsporozoite protein.
Resolution2.103 Å
Binding residue
(original residue number in PDB)		N31 Y32 G33 I50 W52 Y52A F58 A95 A96 Y97 T100
Binding residue
(residue number reindexed from 1)		N31 Y32 G33 I50 W52 Y53 F59 A99 A100 Y101 T104
External links