Structure of PDB 6atv Chain A Binding Site BS01

Receptor Information
>6atv Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIP
VPYVEKYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6atv Molecular Mechanisms of Tight Binding through Fuzzy Interactions.
Resolution1.751 Å
Binding residue
(original residue number in PDB)		F141 D147 E149 D150 P165 E166 Q168 W169 M181 P183 P185
Binding residue
(residue number reindexed from 1)		F8 D14 E16 D17 P32 E33 Q35 W36 M48 P50 P52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6atv, PDBe:6atv, PDBj:6atv
PDBsum6atv
PubMed29590589
UniProtP46108|CRK_HUMAN Adapter molecule crk (Gene Name=CRK)

[Back to BioLiP]