Structure of PDB 6at0 Chain A Binding Site BS01

Receptor Information
>6at0 Chain A (length=53) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEFAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYE
ASR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6at0 Investigation of Trimethyllysine Binding by the HP1 Chromodomain via Unnatural Amino Acid Mutagenesis.
Resolution1.285 Å
Binding residue
(original residue number in PDB)		E22 E23 X24 V26 W45 Y48 E56 N60 D62 C63 L66
Binding residue
(residue number reindexed from 1)		E1 E2 X3 V5 W24 Y27 E35 N39 D41 C42 L45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6at0, PDBe:6at0, PDBj:6at0
PDBsum6at0
PubMed29111699
UniProtP05205|HP1_DROME Heterochromatin protein 1 (Gene Name=Su(var)205)

[Back to BioLiP]