Structure of PDB 6aso Chain A Binding Site BS01

Receptor Information
>6aso Chain A (length=369) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKN
FRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYT
QRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLN
GLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRE
SFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRSLLGN
REISVSLADKKPFLERNEVKRLLASRNSKELETLICLFPLSDKVSPSLIC
QFLQEEIHINEKDIRKILLVSDFNGAIIIFRDSKFAAKMLMILNGSQFQG
KVIRSGTINDMKRYYNNQQ
Ligand information
>6aso Chain I (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caauuugaaacaauacagagaugaucagcgguuccccugcauaaggggaa
ccguuuuacaaagaguuuuu
...<<<<...................<<<<<<<<<<<<.....>>>>>>>
>>>>>...>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6aso Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		N31 L34 T35 R38 W120 T122 N123 R148 S151 R153 F154 R158 R159 F160 Y162 Y186 S193 N194 P195 K198 R201 T202 T206 E211 M213 R215 N216 K239 N241 P243 Q246 F251 N252 N253 C255 F257 S283 D288 K289 K290 P291 F292 L293 R295 K299 N306
Binding residue
(residue number reindexed from 1)		N2 L5 T6 R9 W91 T93 N94 R119 S122 R124 F125 R129 R130 F131 Y133 Y157 S164 N165 P166 K169 R172 T173 T177 E182 M184 R186 N187 K210 N212 P214 Q217 F222 N223 N224 C226 F228 S254 D259 K260 K261 P262 F263 L264 R266 K270 N277
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017069 snRNA binding
GO:0017070 U6 snRNA binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6aso, PDBe:6aso, PDBj:6aso
PDBsum6aso
PubMed29717126
UniProtP49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 (Gene Name=PRP24)

[Back to BioLiP]