Structure of PDB 6akl Chain A Binding Site BS01

Receptor Information
>6akl Chain A (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMV
AK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6akl Architecture, substructures, and dynamic assembly of STRIPAK complexes in Hippo signaling.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		L101 M105 Y108 R109
Binding residue
(residue number reindexed from 1)		L34 M38 Y41 R42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6akl, PDBe:6akl, PDBj:6akl
PDBsum6akl
PubMed30622739
UniProtQ9BRV8|SIKE1_HUMAN Suppressor of IKBKE 1 (Gene Name=SIKE1)

[Back to BioLiP]