Structure of PDB 6ae8 Chain A Binding Site BS01

Receptor Information
>6ae8 Chain A (length=182) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA
RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGN
AAKDLKVKRITPRHLQLAIRGDDELDSLIRAT
Ligand information
>6ae8 Chain C (length=12) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDEDEEDDDFKE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ae8 Structural insights into histone chaperone Chz1-mediated H2A.Z recognition and histone replacement.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		S6 Y10 I22 S23 Q24 K25 M27 R159 T161
Binding residue
(residue number reindexed from 1)		S6 Y10 I22 S23 Q24 K25 M27 R159 T161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6ae8, PDBe:6ae8, PDBj:6ae8
PDBsum6ae8
PubMed31107867
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1);
Q12692

[Back to BioLiP]