Structure of PDB 6aco Chain A Binding Site BS01

Receptor Information
>6aco Chain A (length=270) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQA
QDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQG
RRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICP
ALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAIL
EEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPAT
NRFRFHFQGPCGTTLPEALA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6aco complex structure of histone lysine desuccinylase Sirt5 with succinyl peptide H2BK120
Resolution1.71 Å
Binding residue
(original residue number in PDB)
Y102 R105 I142 H158 V221 F223 G224 E225 N226 L227 L232 V253 V254 Y255
Binding residue
(residue number reindexed from 1)
Y70 R73 I110 H126 V189 F191 G192 E193 N194 L195 L200 V221 V222 Y223
Enzymatic activity
Catalytic site (original residue number in PDB) P68 T69 F70 R71 N141 D143 H158
Catalytic site (residue number reindexed from 1) P36 T37 F38 R39 N109 D111 H126
Enzyme Commision number 2.3.1.-
Gene Ontology
Molecular Function
GO:0036054 protein-malonyllysine demalonylase activity
GO:0036055 protein-succinyllysine desuccinylase activity
GO:0070403 NAD+ binding

View graph for
Molecular Function
External links
PDB RCSB:6aco, PDBe:6aco, PDBj:6aco
PDBsum6aco
PubMed
UniProtQ9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=SIRT5)

[Back to BioLiP]